"event" : "removeThreadUserEmailSubscription", ] { { }, setWarning(pagerId); "event" : "expandMessage", { "selector" : "#kudosButtonV2_0", }, "context" : "", ], { }, "actions" : [ { var clickHandler = function(event) { } "actions" : [ { } ', 'ajax'); "actions" : [ ] "action" : "rerender" }, } "componentId" : "kudos.widget.button", "action" : "rerender" var o = document.getElementById("custom_board_pagination_warning" + pagerId); "actions" : [ setWarning(pagerId); "showCountOnly" : "false", } "action" : "rerender" } }, { ] } ] "event" : "unapproveMessage", "actions" : [ }, o.innerHTML = ""; { { LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); ] "context" : "", ] { "event" : "MessagesWidgetEditAction", ] { ] "truncateBody" : "true", "selector" : "#messageview_8", "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "useSimpleView" : "false", // We made it! } ] "event" : "addThreadUserEmailSubscription", "action" : "rerender" } "disallowZeroCount" : "false", { }, LITHIUM.StarRating('#any_8', false, 1, 'LITHIUM:starRating'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); "action" : "rerender" "selector" : "#kudosButtonV2_3", LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); "event" : "ProductMessageEdit", function doChecks(pagerId, val) { "context" : "", { "defaultAriaLabel" : "", ] "action" : "rerender" } "event" : "MessagesWidgetCommentForm", LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "event" : "ProductAnswer", "event" : "RevokeSolutionAction", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { { "context" : "", })(LITHIUM.jQuery); // Pull in global jQuery reference { }, "event" : "expandMessage", { "defaultAriaLabel" : "", "actions" : [ } "actions" : [ } ] ] "context" : "", LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); "event" : "markAsSpamWithoutRedirect", LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { var watching = false; { LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "event" : "MessagesWidgetEditCommentForm", } { if ( Number(val) > 10 ) // console.log(key); "event" : "AcceptSolutionAction", "action" : "addClassName" "useSimpleView" : "false", } "actions" : [ }, }, }, // --> clearWarning(pagerId); { }, "event" : "addMessageUserEmailSubscription", "context" : "lia-deleted-state", "action" : "rerender" count = 0; }, { "event" : "approveMessage", Plötzlich viele spam mails 2020. }, { "initiatorDataMatcher" : "data-lia-kudos-id" } } LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } "actions" : [ } return; { "eventActions" : [ }, "context" : "", ] "useSimpleView" : "false", } }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "", }, } { Deshalb müssen Sie auf verschiedene Tricks zurückgreifen. "event" : "QuickReply", "actions" : [ // console.log('watching: ' + key); "showCountOnly" : "false", "action" : "pulsate" ] ] { { "action" : "rerender" ] "event" : "unapproveMessage", "context" : "", "selector" : "#kudosButtonV2_4", $(this).next().toggle(); "actions" : [ Aber was, wenn persönliche Daten wie Name, Adresse oder Telefonnummer darin auftauchen? LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); "event" : "expandMessage", { } "context" : "lia-deleted-state", if ( neededkeys[count] == key ) { "action" : "rerender" "showCountOnly" : "false", "actions" : [ { }, { } "action" : "addClassName" "dialogKey" : "dialogKey" "action" : "rerender" { { "selector" : "#kudosButtonV2_8", { "event" : "removeThreadUserEmailSubscription", "truncateBodyRetainsHtml" : "false", "useCountToKudo" : "false", "event" : "ProductMessageEdit", } { }, if (isNaN(val) ) "event" : "QuickReply", "context" : "envParam:selectedMessage", }); LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); { LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "disableLinks" : "false", }, { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); { LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, '5lGqUVJgsTEV3XWym56n-zBotwQzrO6_2Y-fyNTk4YY. } "kudosable" : "true", } "kudosLinksDisabled" : "false", ] "actions" : [ } "actions" : [ LITHIUM.AjaxSupport.fromForm('#form_7', 'GiveRating', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "message" : "2435011", ;(function($) { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); count = 0; // Oops. "}); "truncateBody" : "true", "event" : "deleteMessage", "initiatorBinding" : true, "context" : "", { "action" : "pulsate" "}); watching = false; ] LITHIUM.AjaxSupport.ComponentEvents.set({ } "event" : "removeThreadUserEmailSubscription", "actions" : [ "action" : "rerender" } LITHIUM.Dialog({ "actions" : [ }, "event" : "removeMessageUserEmailSubscription", if ( key == neededkeys[0] ) { }, "context" : "", "context" : "envParam:quiltName,expandedQuiltName", { "}); "action" : "rerender" { } } "context" : "", "context" : "", { "; { "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetEditAnswerForm", { "event" : "ProductAnswer", "action" : "rerender" "displayStyle" : "horizontal", Hallo, seit gestern Nachmittag erscheinen bei mir mehrere Windows 10-eigene Apps in englischer Sprache. "dialogContentCssClass" : "lia-panel-dialog-content", } "action" : "rerender" "eventActions" : [ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } { ;(function($) { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown","menuItemsSelector":".lia-menu-dropdown-items"}}); "kudosable" : "true", LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, '5lGqUVJgsTEV3XWym56n-zBotwQzrO6_2Y-fyNTk4YY. { { } "disallowZeroCount" : "false", }, } { }, "actions" : [ ], logmein: [76, 79, 71, 77, 69, 73, 78], "context" : "envParam:quiltName,expandedQuiltName", "disallowZeroCount" : "false", ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] { "actions" : [ "actions" : [ "; "context" : "", "context" : "", } { { }, { { "actions" : [ } }, }, "parameters" : { "forceSearchRequestParameterForBlurbBuilder" : "false", ;(function($) { "event" : "QuickReply", document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); "event" : "editProductMessage", { }, { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); { })(LITHIUM.jQuery); "event" : "unapproveMessage", } "action" : "pulsate" ] }, LITHIUM.Dialog({ "kudosLinksDisabled" : "false", "context" : "", "context" : "lia-deleted-state", "context" : "envParam:quiltName", "entity" : "2435024", }, ], ] "useTruncatedSubject" : "true", "context" : "", { "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "event" : "removeMessageUserEmailSubscription", LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); } "initiatorBinding" : true, "kudosLinksDisabled" : "false", LITHIUM.Auth.CHECK_SESSION_TOKEN = 'OQfJT6xG65jmdCVX-WMefw_5P9TAYJz_xJdMU129JKQ. "quiltName" : "ForumMessage", "context" : "", { "actions" : [ ] }, 192 Kommentare. { "action" : "rerender" { "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_39","feedbackSelector":".InfoMessage"}); } "event" : "editProductMessage", "useTruncatedSubject" : "true", "message" : "2435048", "}); return false; "actions" : [ "context" : "", "event" : "addThreadUserEmailSubscription", Bist du sicher, dass du fortfahren möchtest? "event" : "ProductAnswerComment", "action" : "rerender" "actions" : [ "linkDisabled" : "false" LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "QuickReply", ] "messageViewOptions" : "1111110111111111111110111110100101001101" "action" : "rerender" "event" : "approveMessage", "event" : "ProductAnswerComment", "action" : "pulsate" "actions" : [ "selector" : "#messageview_2", ] "context" : "", "event" : "editProductMessage", "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" "dialogKey" : "dialogKey" LITHIUM.AjaxSupport.ComponentEvents.set({ "selector" : "#kudosButtonV2_8", ] "event" : "deleteMessage", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } "event" : "MessagesWidgetMessageEdit", ] "context" : "envParam:entity", "event" : "MessagesWidgetEditAction", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "componentId" : "forums.widget.message-view", ] "context" : "envParam:feedbackData", } "disableLinks" : "false", "event" : "ProductMessageEdit", "event" : "deleteMessage", "action" : "rerender" "truncateBodyRetainsHtml" : "false", } // We made it! setWarning(pagerId); }, "displayStyle" : "horizontal", { "initiatorDataMatcher" : "data-lia-message-uid" setWarning(pagerId); "event" : "expandMessage", "action" : "rerender" } // If watching, pay attention to key presses, looking for right sequence. "context" : "envParam:quiltName", { } "action" : "rerender" "event" : "addMessageUserEmailSubscription", "action" : "rerender" "event" : "kudoEntity", document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); "action" : "rerender" "context" : "envParam:feedbackData", //resetMenu(); }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); { "context" : "", "revokeMode" : "true", "actions" : [ "action" : "rerender" }, $(document).ready(function(){ }, "context" : "", "action" : "rerender" } "action" : "pulsate" setWarning(pagerId); "event" : "MessagesWidgetMessageEdit", LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "", "useCountToKudo" : "false", "event" : "RevokeSolutionAction", { { Doch was bringen Filter, Datensparsamkeit und. { } "context" : "lia-deleted-state", } "messageViewOptions" : "1111110111111111111110111110100101001101" if (val.trim() == "") LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); { { $('#vodafone-community-header .lia-search-toggle').click(function() { ] ;(function($) { "action" : "rerender" "action" : "rerender" ] LITHIUM.Auth.CHECK_SESSION_TOKEN = 'OQfJT6xG65jmdCVX-WMefw_5P9TAYJz_xJdMU129JKQ. "disableLinks" : "false", { "context" : "", "context" : "", ] { ] "closeImageIconURL" : "https://forum.vodafone.de/skins/images/EE4ADC993AA021EAB7DE192BDBFD2A95/responsive_peak/images/button_dialog_close.svg", "event" : "MessagesWidgetAnswerForm", watching = false; ] "context" : "envParam:entity", $(document).ready(function(){ } } ] "actions" : [ "event" : "removeThreadUserEmailSubscription", "actions" : [ "actions" : [ "context" : "", Bist du sicher, dass du fortfahren möchtest? }); } ', 'ajax'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); lithstudio: [], LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); { }, ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" { "actions" : [ { } lithstudio: [], "action" : "rerender" ', 'ajax'); "event" : "ProductAnswer", { ] { if ( neededkeys[count] == key ) { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_43","feedbackSelector":".InfoMessage"}); ], "truncateBodyRetainsHtml" : "false", "action" : "rerender" "actions" : [ // Oops, not the right sequence, lets restart from the top. Bitte, emails können weder gesendet noch abgerufen werden, Emails an Freenet-Nutzer werden abgelehnt, Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_862529d5f40829_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/7001/thread-id/102556&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); } { }, "actions" : [ > 0) ) "context" : "envParam:quiltName", ] }); { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2434446,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren.